SCOPe 2.03: Domain d3ty6b_: 3ty6 B:

Lineage for d3ty6b_ (3ty6 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (7 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [189742] (1 PDB entry)

8. Domain d3ty6b_: 3ty6 B: [186008]
   automated match to d1yyfc1
   complexed with so4

Details for d3ty6b_

PDB Entry: 3ty6, 2.5 Å

PDB Description: atp-dependent protease hslv from bacillus anthracis str. ames

PDB Compounds: (B:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d3ty6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ty6b_ d.153.1.4 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel

Timeline for d3ty6b_:

• d3ty6b_ first appeared in SCOPe 2.01
  
• d3ty6b_ appears in SCOPe 2.02
  
• d3ty6b_ appears in SCOPe 2.04
  
• d3ty6b_ appears in the current release, SCOPe 2.08