SCOP 1.67: Domain d2cyp__: 2cyp -

Lineage for d2cyp__ (2cyp -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (81 PDB entries)

8. Domain d2cyp__: 2cyp - [18600]
   complexed with hem

Details for d2cyp__

PDB Entry: 2cyp, 1.7 Å

PDB Description: crystal structure of yeast cytochrome c peroxidase refined at 1.7- angstroms resolution

SCOP Domain Sequences for d2cyp__:

Sequence; same for both SEQRES and ATOM records:

>d2cyp__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2cyp__:

• d2cyp__ first appeared (with stable ids) in SCOP 1.55
  
• d2cyp__ appears in SCOP 1.65
  
• d2cyp__ appears in SCOP 1.69
  
• d2cyp__ appears in the current release, SCOPe 2.08, called d2cypa_