Lineage for d1gzaa_ (1gza A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773392Protein Fungal peroxidase (ligninase) [88935] (4 species)
  7. 773393Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)
  8. 773407Domain d1gzaa_: 1gza A: [18599]
    complexed with ca, hem, iod, nag

Details for d1gzaa_

PDB Entry: 1gza (more details), 2.06 Å

PDB Description: peroxidase
PDB Compounds: (A:) Peroxidase

SCOP Domain Sequences for d1gzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzaa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d1gzaa_:

Click to download the PDB-style file with coordinates for d1gzaa_.
(The format of our PDB-style files is described here.)

Timeline for d1gzaa_: