Lineage for d1gza__ (1gza -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Peroxidase [48117] (1 species) Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries) 
Domain d1gza__: 1gza - [18599]
Details for d1gza__
PDB Entry: 1gza (more details), 2.06 Å
PDB Description: peroxidase
SCOP Domain Sequences for d1gza__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gza__ a.93.1.1 (-) Peroxidase {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap
SCOP Domain Coordinates for d1gza__:
Click to download the PDB-style file with coordinates for d1gza__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gza__:
- d1gza__ appears in SCOP 1.57
- d1gza__ appears in the current release, SCOPe 2.08, called d1gzaa_
View in 3D