Lineage for d1arp__ (1arp -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541093Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 541198Protein Fungal peroxidase (ligninase) [88935] (4 species)
  7. 541199Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries)
  8. 541208Domain d1arp__: 1arp - [18597]
    complexed with ca, hem, nag

Details for d1arp__

PDB Entry: 1arp (more details), 1.9 Å

PDB Description: crystal structure of the fungal peroxidase from arthromyces ramosus at 1.9 angstroms resolution: structural comparisons with the lignin and cytochrome c peroxidases

SCOP Domain Sequences for d1arp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arp__ a.93.1.1 (-) Fungal peroxidase (ligninase) {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOP Domain Coordinates for d1arp__:

Click to download the PDB-style file with coordinates for d1arp__.
(The format of our PDB-style files is described here.)

Timeline for d1arp__: