Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein automated matches [191082] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189791] (7 PDB entries) |
Domain d3tw2a_: 3tw2 A: [185969] automated match to d1av5a_ complexed with amp |
PDB Entry: 3tw2 (more details), 1.38 Å
SCOPe Domain Sequences for d3tw2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tw2a_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} arpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddd esllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d3tw2a_: