SCOPe 2.06: Domain d3tuyf_: 3tuy F:

Lineage for d3tuyf_ (3tuy F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Placopecten magellanicus [TaxId:6577] [189594] (3 PDB entries)

8. Domain d3tuyf_: 3tuy F: [185963]
   automated match to d1qviz_
   complexed with ca, mg

Details for d3tuyf_

PDB Entry: 3tuy, 2.5 Å

PDB Description: Phosphorylated Light Chain Domain of Scallop smooth Muscle Myosin

PDB Compounds: (F:) myosin essential light chain

SCOPe Domain Sequences for d3tuyf_:

Sequence; same for both SEQRES and ATOM records:

>d3tuyf_ a.39.1.5 (F:) automated matches {Placopecten magellanicus [TaxId: 6577]}
klsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsdee
vdeiinltdlqedlegnvkyeefvkkvmtgp

Timeline for d3tuyf_:

• d3tuyf_ first appeared in SCOPe 2.01
  
• d3tuyf_ appears in SCOPe 2.05
  
• d3tuyf_ appears in SCOPe 2.07
  
• d3tuyf_ appears in the current release, SCOPe 2.08