Lineage for d1hsra_ (1hsr A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741523Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 1741524Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)
  8. 1741531Domain d1hsra_: 1hsr A: [18592]
    complexed with bho, ca, hem

Details for d1hsra_

PDB Entry: 1hsr (more details), 1.6 Å

PDB Description: binding mode of benzhydroxamic acid to arthromyces ramosus peroxidase
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1hsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsra_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1hsra_:

Click to download the PDB-style file with coordinates for d1hsra_.
(The format of our PDB-style files is described here.)

Timeline for d1hsra_: