Lineage for d3tqaa_ (3tqa A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904150Species Coxiella burnetii [TaxId:777] [189790] (4 PDB entries)
  8. 2904152Domain d3tqaa_: 3tqa A: [185907]
    automated match to d1ddra_
    complexed with ndp

Details for d3tqaa_

PDB Entry: 3tqa (more details), 2.3 Å

PDB Description: structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3tqaa_:

Sequence, based on SEQRES records: (download)

>d3tqaa_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdeknpypfqflelrr

Sequence, based on observed residues (ATOM records): (download)

>d3tqaa_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn
ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs
fegdvyfpewndkewkitsqikherdnpypfqflelrr

SCOPe Domain Coordinates for d3tqaa_:

Click to download the PDB-style file with coordinates for d3tqaa_.
(The format of our PDB-style files is described here.)

Timeline for d3tqaa_: