SCOP 1.63: Domain d1arv__: 1arv -

Lineage for d1arv__ (1arv -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (6 proteins)

6. Protein Peroxidase [48117] (2 species)

7. Species Arthromyces ramosus [TaxId:5451] [48118] (11 PDB entries)

8. Domain d1arv__: 1arv - [18590]
   complexed with ca, cyn, hem, nag

Details for d1arv__

PDB Entry: 1arv, 1.6 Å

PDB Description: crystal structures of cyanide-and triiodide-bound forms of arthromyces ramosus peroxidase at different ph values. perturbations of active site residues and their implication in enzyme catalysis

SCOP Domain Sequences for d1arv__:

Sequence; same for both SEQRES and ATOM records:

>d1arv__ a.93.1.1 (-) Peroxidase {Arthromyces ramosus}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

Timeline for d1arv__:

• d1arv__ first appeared (with stable ids) in SCOP 1.55
  
• d1arv__ appears in SCOP 1.61
  
• d1arv__ appears in SCOP 1.65
  
• d1arv__ appears in the current release, SCOPe 2.08, called d1arva_