SCOPe 2.08: Domain d3tkkb1: 3tkk B:1-299

Lineage for d3tkkb1 (3tkk B:1-299)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families)
   decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243

5. Family b.23.3.0: automated matches [191463] (1 protein)
   not a true family

6. Protein automated matches [190714] (2 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [189810] (2 PDB entries)

8. Domain d3tkkb1: 3tkk B:1-299 [185868]
   Other proteins in same PDB: d3tkka2, d3tkkb2, d3tkkc2, d3tkkd2
   automated match to d2f4la1
   complexed with ca, zn

Details for d3tkkb1

PDB Entry: 3tkk, 1.99 Å

PDB Description: Crystal Structure Analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis

PDB Compounds: (B:) Predicted acetamidase/formamidase

SCOPe Domain Sequences for d3tkkb1:

Sequence; same for both SEQRES and ATOM records:

>d3tkkb1 b.23.3.0 (B:1-299) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkyslsadhhifafskenkpaisvksgdelevetmdcfsnqiqsnedkldemdwnrvnpa
tgpifvegakegdvlkvkikkievaekgvlatgkglgvlgnlmeglyskvvdikdgkvif
neklalpvkpmigvigvapkegsincgtpgshggnmdttliaegaevyfpvfvegallal
gdlhalmgdgevgvsgvevagkvllevevikglnlknpvvktaevtatiasaesldkave
iavhdmaelfkkhtdlstegiatlfsitgnaqisqvvdplktarfslpnwilesygirf

Timeline for d3tkkb1:

• d3tkkb1 first appeared in SCOPe 2.01, called d3tkkb_
  
• d3tkkb1 appears in SCOPe 2.07