Lineage for d1b82b_ (1b82 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5256Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 5331Protein Lignin peroxidase [48115] (1 species)
  7. 5332Species White rot basidiomycete (Phanerochaete chrysosporium) [TaxId:5306] [48116] (6 PDB entries)
  8. 5339Domain d1b82b_: 1b82 B: [18584]

Details for d1b82b_

PDB Entry: 1b82 (more details), 1.8 Å

PDB Description: pristine recomb. lignin peroxidase h8

SCOP Domain Sequences for d1b82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b82b_ a.93.1.1 (B:) Lignin peroxidase {White rot basidiomycete (Phanerochaete chrysosporium)}
ratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispameaq
gkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagavalsn
cpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsahsva
avndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsdh
tiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgnl
pfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga

SCOP Domain Coordinates for d1b82b_:

Click to download the PDB-style file with coordinates for d1b82b_.
(The format of our PDB-style files is described here.)

Timeline for d1b82b_: