Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
Protein Arginase [52770] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries) Uniprot P05089 5-313 |
Domain d3tf3b_: 3tf3 B: [185811] automated match to d1wvaa1 |
PDB Entry: 3tf3 (more details), 1.64 Å
SCOPe Domain Sequences for d3tf3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tf3b_ c.42.1.1 (B:) Arginase {Human (Homo sapiens) [TaxId: 9606]} rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg laregnhkpidyln
Timeline for d3tf3b_: