Lineage for d3te5a_ (3te5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539572Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2539581Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2539603Protein automated matches [190788] (2 species)
    not a true protein
  7. 2539604Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189800] (3 PDB entries)
  8. 2539607Domain d3te5a_: 3te5 A: [185797]
    Other proteins in same PDB: d3te5c1, d3te5c2
    automated match to d2qlva1
    complexed with nai

Details for d3te5a_

PDB Entry: 3te5 (more details), 2.5 Å

PDB Description: structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with NADH
PDB Compounds: (A:) Carbon catabolite-derepressing protein kinase

SCOPe Domain Sequences for d3te5a_:

Sequence, based on SEQRES records: (download)

>d3te5a_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiy
ialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnnylvd
fkfdgwessygddttvsnisedemstfsaypflhlttklimelavns

Sequence, based on observed residues (ATOM records): (download)

>d3te5a_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiy
ialknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesfsa
ypflhlttklimelavns

SCOPe Domain Coordinates for d3te5a_:

Click to download the PDB-style file with coordinates for d3te5a_.
(The format of our PDB-style files is described here.)

Timeline for d3te5a_: