Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.6: KA1-like [103243] (3 families) contains a single copy of this fold |
Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
Protein automated matches [190788] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189800] (3 PDB entries) |
Domain d3tdha_: 3tdh A: [185794] Other proteins in same PDB: d3tdhc1, d3tdhc2 automated match to d2qlva1 complexed with amp |
PDB Entry: 3tdh (more details), 2.3 Å
SCOPe Domain Sequences for d3tdha_:
Sequence, based on SEQRES records: (download)
>d3tdha_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi alknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnnylvdf kfdgwessygddttvsnisedemstfsaypflhlttklimelavns
>d3tdha_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi alknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesstfs aypflhlttklimelavns
Timeline for d3tdha_: