Lineage for d3tddk_ (3tdd K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677537Domain d3tddk_: 3tdd K: [185779]
    Other proteins in same PDB: d3tdda_, d3tddb_, d3tddc_, d3tdde_, d3tddf_, d3tddg_, d3tddo_, d3tddp_, d3tddq_, d3tdds_, d3tddt_, d3tddu_
    automated match to d1g0uk_
    complexed with bfo

Details for d3tddk_

PDB Entry: 3tdd (more details), 2.7 Å

PDB Description: Crystal structure of yeast CP in complex with Belactosin C
PDB Compounds: (K:) Proteasome component PRE2

SCOPe Domain Sequences for d3tddk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tddk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d3tddk_:

Click to download the PDB-style file with coordinates for d3tddk_.
(The format of our PDB-style files is described here.)

Timeline for d3tddk_: