Details for d1jdbb1

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbb1 a.92.1.1 (B:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
vgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwfl
vqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydlh
pvykrvdtcaaefatdtaymystyeeeceanps

SCOP Domain Coordinates for d1jdbb1:

Click to download the PDB-style file with coordinates for d1jdbb1.
(The format of our PDB-style files is described here.)

Timeline for d1jdbb1: