Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189828] (2 PDB entries) |
Domain d3ta6a_: 3ta6 A: [185739] automated match to d1b9bb_ complexed with flc |
PDB Entry: 3ta6 (more details), 1.41 Å
SCOPe Domain Sequences for d3ta6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ta6a_ c.1.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdkl rltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaatal khgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgrv asaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvggas ldgehfatlaaiaag
Timeline for d3ta6a_: