Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries) |
Domain d3t9ze1: 3t9z E:1-109 [185721] Other proteins in same PDB: d3t9za2, d3t9zb2, d3t9zc2, d3t9zd2, d3t9ze2, d3t9zf2 automated match to d1qy7a_ complexed with flc |
PDB Entry: 3t9z (more details), 1.82 Å
SCOPe Domain Sequences for d3t9ze1:
Sequence, based on SEQRES records: (download)
>d3t9ze1 d.58.5.0 (E:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev
>d3t9ze1 d.58.5.0 (E:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} mkmvvavirpeklecvkkaleergfvgmtvtevkgrgdllqktkvevvvsddavdevvea ivssartgkfgdgrifvipveksvkirtgdeev
Timeline for d3t9ze1: