Lineage for d3t9ze1 (3t9z E:1-109)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950886Species Archaeoglobus fulgidus [TaxId:224325] [189774] (4 PDB entries)
  8. 2950894Domain d3t9ze1: 3t9z E:1-109 [185721]
    Other proteins in same PDB: d3t9za2, d3t9zb2, d3t9zc2, d3t9zd2, d3t9ze2, d3t9zf2
    automated match to d1qy7a_
    complexed with flc

Details for d3t9ze1

PDB Entry: 3t9z (more details), 1.82 Å

PDB Description: a. fulgidus glnk3, ligand-free
PDB Compounds: (E:) Nitrogen regulatory protein P-II (GlnB-3)

SCOPe Domain Sequences for d3t9ze1:

Sequence, based on SEQRES records: (download)

>d3t9ze1 d.58.5.0 (E:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgeqkgirlqfrgrevevdllqktk
vevvvsddavdevveaivssartgkfgdgrifvipveksvkirtgdeev

Sequence, based on observed residues (ATOM records): (download)

>d3t9ze1 d.58.5.0 (E:1-109) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mkmvvavirpeklecvkkaleergfvgmtvtevkgrgdllqktkvevvvsddavdevvea
ivssartgkfgdgrifvipveksvkirtgdeev

SCOPe Domain Coordinates for d3t9ze1:

Click to download the PDB-style file with coordinates for d3t9ze1.
(The format of our PDB-style files is described here.)

Timeline for d3t9ze1: