Lineage for d1bxrc1 (1bxr C:403-555)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5221Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
  4. 5222Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 5223Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 5224Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 5225Species Escherichia coli [TaxId:562] [48111] (7 PDB entries)
  8. 5247Domain d1bxrc1: 1bxr C:403-555 [18571]
    Other proteins in same PDB: d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2

Details for d1bxrc1

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrc1 a.92.1.1 (C:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1bxrc1:

Click to download the PDB-style file with coordinates for d1bxrc1.
(The format of our PDB-style files is described here.)

Timeline for d1bxrc1: