SCOPe 2.08: Domain d3t80e1: 3t80 E:1-156

Lineage for d3t80e1 (3t80 E:1-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein automated matches [190985] (6 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189751] (2 PDB entries)

8. Domain d3t80e1: 3t80 E:1-156 [185683]
   Other proteins in same PDB: d3t80a2, d3t80b2, d3t80c2, d3t80d2, d3t80e2, d3t80f2
   automated match to d1h48c_
   complexed with ctn, edo, mg, pop, zn

Details for d3t80e1

PDB Entry: 3t80, 2.5 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine

PDB Compounds: (E:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3t80e1:

Sequence; same for both SEQRES and ATOM records:

>d3t80e1 d.79.5.1 (E:1-156) automated matches {Salmonella typhimurium [TaxId: 90371]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmdevnvkattteklgftgrgegiaceavallmk

Timeline for d3t80e1:

• d3t80e1 first appeared in SCOPe 2.01, called d3t80e_
  
• d3t80e1 appears in SCOPe 2.07