SCOPe 2.02: Domain d3t77b2: 3t77 B:112-213

Lineage for d3t77b2 (3t77 B:112-213)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d3t77b2: 3t77 B:112-213 [185670]
   Other proteins in same PDB: d3t77a1, d3t77a2, d3t77b1
   part of Fab s25-2
   complexed with mg, zn

Details for d3t77b2

PDB Entry: 3t77, 1.74 Å

PDB Description: s25-2- a(2-4)kdo disaccharide complex

PDB Compounds: (B:) S25-2 Fab (IgG1k) heavy chain

SCOPe Domain Sequences for d3t77b2:

Sequence; same for both SEQRES and ATOM records:

>d3t77b2 b.1.1.2 (B:112-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d3t77b2:

• d3t77b2 first appeared in SCOPe 2.01
  
• d3t77b2 appears in SCOPe 2.03
  
• d3t77b2 appears in the current release, SCOPe 2.08