SCOPe 2.04: Domain d3t6ka_: 3t6k A:

Lineage for d3t6ka_ (3t6k A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Chloroflexus aurantiacus [TaxId:324602] [189714] (1 PDB entry)

8. Domain d3t6ka_: 3t6k A: [185664]
   automated match to d1mvoa_
   complexed with edo, so4

Details for d3t6ka_

PDB Entry: 3t6k, 1.86 Å

PDB Description: crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution

PDB Compounds: (A:) Response regulator receiver

SCOPe Domain Sequences for d3t6ka_:

Sequence; same for both SEQRES and ATOM records:

>d3t6ka_ c.23.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
kphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpgid
gytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvknil
ar

Timeline for d3t6ka_:

• d3t6ka_ first appeared in SCOPe 2.01
  
• d3t6ka_ appears in SCOPe 2.03
  
• d3t6ka_ appears in SCOPe 2.05
  
• d3t6ka_ appears in the current release, SCOPe 2.08