Lineage for d3t4na_ (3t4n A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2215471Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2215480Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2215502Protein automated matches [190788] (2 species)
    not a true protein
  7. 2215503Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189800] (3 PDB entries)
  8. 2215504Domain d3t4na_: 3t4n A: [185643]
    Other proteins in same PDB: d3t4nc1, d3t4nc2
    automated match to d2qlva1
    complexed with adp

Details for d3t4na_

PDB Entry: 3t4n (more details), 2.3 Å

PDB Description: Structure of the regulatory fragment of Saccharomyces cerevisiae AMPK in complex with ADP
PDB Compounds: (A:) Carbon catabolite-derepressing protein kinase

SCOPe Domain Sequences for d3t4na_:

Sequence, based on SEQRES records: (download)

>d3t4na_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
alknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnnylvdf
kfdgwessygddttvsnisedemstfsaypflhlttklimelavns

Sequence, based on observed residues (ATOM records): (download)

>d3t4na_ d.129.6.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
alknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesstfs
aypflhlttklimelavns

SCOPe Domain Coordinates for d3t4na_:

Click to download the PDB-style file with coordinates for d3t4na_.
(The format of our PDB-style files is described here.)

Timeline for d3t4na_: