Details for d1cs0c1

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0c1 a.92.1.1 (C:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1cs0c1:

Click to download the PDB-style file with coordinates for d1cs0c1.
(The format of our PDB-style files is described here.)

Timeline for d1cs0c1: