Lineage for d3sy0b1 (3sy0 B:1-111)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103715Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1103718Domain d3sy0b1: 3sy0 B:1-111 [185583]
    Other proteins in same PDB: d3sy0a1, d3sy0a2, d3sy0b2
    part of Fab s25-2
    complexed with mg, zn

Details for d3sy0b1

PDB Entry: 3sy0 (more details), 1.49 Å

PDB Description: s25-2- a(2-8)-a(2-4)kdo trisaccharide complex
PDB Compounds: (B:) S25-2 Fab (IgG1k) heavy chain

SCOPe Domain Sequences for d3sy0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sy0b1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

SCOPe Domain Coordinates for d3sy0b1:

Click to download the PDB-style file with coordinates for d3sy0b1.
(The format of our PDB-style files is described here.)

Timeline for d3sy0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sy0b2