Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (3 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [189773] (1 PDB entry) |
Domain d3swnp_: 3swn P: [185573] automated match to d2fwka1 protein/RNA complex; complexed with zn |
PDB Entry: 3swn (more details), 2.5 Å
SCOPe Domain Sequences for d3swnp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swnp_ b.38.1.0 (P:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} tilplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsem llngngmcmlipggkp
Timeline for d3swnp_: