SCOPe 2.03: Domain d3ssxn_: 3ssx N:

Lineage for d3ssxn_ (3ssx N:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (3 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (1 protein)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (14 PDB entries)

8. Domain d3ssxn_: 3ssx N: [185511]
   automated match to d1co0a_
   complexed with tam; mutant

Details for d3ssxn_

PDB Entry: 3ssx, 1.58 Å

PDB Description: E. coli trp aporeporessor L75F mutant

PDB Compounds: (N:) trp operon repressor

SCOPe Domain Sequences for d3ssxn_:

Sequence; same for both SEQRES and ATOM records:

>d3ssxn_ a.4.12.1 (N:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
saamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgems
qrelknefgagiatitrgsnslkaapvelrqwleevllk

Timeline for d3ssxn_:

• d3ssxn_ first appeared in SCOPe 2.01
  
• d3ssxn_ appears in SCOPe 2.02
  
• d3ssxn_ appears in SCOPe 2.04
  
• d3ssxn_ appears in the current release, SCOPe 2.08