Lineage for d1a9xc1 (1a9x C:2403-2555)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358287Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    possible duplication: subdomains have similar topologies
  4. 358288Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 358289Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 358290Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 358291Species Escherichia coli [TaxId:562] [48111] (9 PDB entries)
  8. 358293Domain d1a9xc1: 1a9x C:2403-2555 [18551]
    Other proteins in same PDB: d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2

Details for d1a9xc1

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xc1 a.92.1.1 (C:2403-2555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1a9xc1:

Click to download the PDB-style file with coordinates for d1a9xc1.
(The format of our PDB-style files is described here.)

Timeline for d1a9xc1: