![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Pyrococcus furiosus [TaxId:186497] [189847] (1 PDB entry) |
![]() | Domain d3ss2a_: 3ss2 A: [185507] automated match to d1bq8a_ complexed with dod, fe |
PDB Entry: 3ss2 (more details), 1.75 Å
SCOPe Domain Sequences for d3ss2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ss2a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 186497]} akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekl
Timeline for d3ss2a_: