SCOPe 2.06: Domain d3srxa1: 3srx A:37-270

Lineage for d3srxa1 (3srx A:37-270)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d3srxa1: 3srx A:37-270 [185503]
   Other proteins in same PDB: d3srxa2
   automated match to d1ko2a_
   complexed with cd, cl, gol, scn

Details for d3srxa1

PDB Entry: 3srx, 2.5 Å

PDB Description: New Delhi Metallo-beta-Lactamase-1 Complexed with Cd

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3srxa1:

Sequence; same for both SEQRES and ATOM records:

>d3srxa1 d.157.1.0 (A:37-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
nymetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtdd
qtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmva
aqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskak
slgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d3srxa1:

• d3srxa1 first appeared in SCOPe 2.01, called d3srxa_
  
• d3srxa1 was called d3srxa_ in SCOPe 2.05
  
• d3srxa1 appears in SCOPe 2.07
  
• d3srxa1 appears in the current release, SCOPe 2.08