Lineage for d3srvb_ (3srv B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221427Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1221428Species Human (Homo sapiens) [TaxId:9606] [118132] (11 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1221432Domain d3srvb_: 3srv B: [185501]
    automated match to d1xbaa_
    complexed with gol, s19

Details for d3srvb_

PDB Entry: 3srv (more details), 1.95 Å

PDB Description: Crystal structure of spleen tyrosine kinase (SYK) in complex with a diaminopyrimidine carboxamide inhibitor
PDB Compounds: (B:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d3srvb_:

Sequence, based on SEQRES records: (download)

>d3srvb_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapec
inyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremyd
lmnlcwtydvenrpgfaavelrlrnyyyd

Sequence, based on observed residues (ATOM records): (download)

>d3srvb_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqldn
pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykf
ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
tydvenrpgfaavelrlrnyyyd

SCOPe Domain Coordinates for d3srvb_:

Click to download the PDB-style file with coordinates for d3srvb_.
(The format of our PDB-style files is described here.)

Timeline for d3srvb_: