Details for d1a9xa1

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis

SCOP Domain Sequences for d1a9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xa1 a.92.1.1 (A:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1a9xa1:

Click to download the PDB-style file with coordinates for d1a9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1a9xa1: