Lineage for d3soib_ (3soi B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244965Protein automated matches [190161] (23 species)
    not a true protein
  7. 2244968Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries)
  8. 2244975Domain d3soib_: 3soi B: [185473]
    automated match to d2blma_
    complexed with cit

Details for d3soib_

PDB Entry: 3soi (more details), 1.73 Å

PDB Description: Crystallographic structure of Bacillus licheniformis beta-lactamase W210F/W229F/W251F at 1.73 angstrom resolution
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3soib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3soib_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidfmkr
nttgdaliragvpdgfevadktgaasygtrndiaiifppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d3soib_:

Click to download the PDB-style file with coordinates for d3soib_.
(The format of our PDB-style files is described here.)

Timeline for d3soib_: