Lineage for d3so1d_ (3so1 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773621Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries)
  8. 2773626Domain d3so1d_: 3so1 D: [185463]
    automated match to d1npsa_
    complexed with ca, so4; mutant

Details for d3so1d_

PDB Entry: 3so1 (more details), 1.85 Å

PDB Description: Crystal structure of a double mutant T41S T82S of a betagamma-crystallin domain from Clostridium beijerinckii
PDB Compounds: (D:) Clostrillin

SCOPe Domain Sequences for d3so1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so1d_ b.11.1.0 (D:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
kwtytsdtpwvgndandkmssvkiyst

SCOPe Domain Coordinates for d3so1d_:

Click to download the PDB-style file with coordinates for d3so1d_.
(The format of our PDB-style files is described here.)

Timeline for d3so1d_: