Lineage for d1fqkb_ (1fqk B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5198Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
  4. 5199Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 5200Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (4 proteins)
  6. 5214Protein RGS9, RGS domain [48101] (1 species)
  7. 5215Species Cow (Bos taurus) [TaxId:9913] [48102] (3 PDB entries)
  8. 5219Domain d1fqkb_: 1fqk B: [18545]
    Other proteins in same PDB: d1fqka1, d1fqka2, d1fqkc1, d1fqkc2

Details for d1fqkb_

PDB Entry: 1fqk (more details), 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqkb_ a.91.1.1 (B:) RGS9, RGS domain {Cow (Bos taurus)}
lvdiptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlkygdqskv
kekaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlmkkdsyar
ylkspiykemlakaie

SCOP Domain Coordinates for d1fqkb_:

Click to download the PDB-style file with coordinates for d1fqkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fqkb_: