Lineage for d3shjs_ (3shj S:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935013Domain d3shjs_: 3shj S: [185396]
    Other proteins in same PDB: d3shj1_, d3shj2_, d3shjd_, d3shjg_, d3shjh_, d3shji_, d3shjj_, d3shjk_, d3shjl_, d3shjm_, d3shjn_, d3shjr_, d3shju_, d3shjv_, d3shjw_, d3shjx_, d3shjy_, d3shjz_
    automated match to d1g65e_
    complexed with h10, mes

Details for d3shjs_

PDB Entry: 3shj (more details), 2.8 Å

PDB Description: Proteasome in complex with hydroxyurea derivative HU10
PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3shjs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shjs_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d3shjs_:

Click to download the PDB-style file with coordinates for d3shjs_.
(The format of our PDB-style files is described here.)

Timeline for d3shjs_: