SCOPe 2.06: Domain d3shjg_: 3shj G:

Lineage for d3shjg_ (3shj G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)

8. Domain d3shjg_: 3shj G: [185385]
   Other proteins in same PDB: d3shj1_, d3shj2_, d3shja_, d3shjb_, d3shjc_, d3shjd_, d3shje_, d3shjf_, d3shjh_, d3shji_, d3shjj_, d3shjk_, d3shjl_, d3shjm_, d3shjn_, d3shjo_, d3shjp_, d3shjq_, d3shjr_, d3shjs_, d3shjt_, d3shjv_, d3shjw_, d3shjx_, d3shjy_, d3shjz_
   automated match to d1g65g_
   complexed with h10, mes

Details for d3shjg_

PDB Entry: 3shj, 2.8 Å

PDB Description: Proteasome in complex with hydroxyurea derivative HU10

PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3shjg_:

Sequence; same for both SEQRES and ATOM records:

>d3shjg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

Timeline for d3shjg_:

• d3shjg_ first appeared in SCOPe 2.01
  
• d3shjg_ appears in SCOPe 2.05
  
• d3shjg_ appears in SCOPe 2.07
  
• d3shjg_ appears in the current release, SCOPe 2.08