Lineage for d3shjg_ (3shj G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045999Species Saccharomyces cerevisiae [TaxId:559292] [189752] (2 PDB entries)
  8. 1046002Domain d3shjg_: 3shj G: [185385]
    Other proteins in same PDB: d3shj1_, d3shj2_, d3shja_, d3shjb_, d3shjc_, d3shje_, d3shjf_, d3shjh_, d3shji_, d3shjj_, d3shjk_, d3shjl_, d3shjm_, d3shjn_, d3shjo_, d3shjp_, d3shjq_, d3shjs_, d3shjt_, d3shjv_, d3shjw_, d3shjx_, d3shjy_, d3shjz_
    automated match to d1g65g_
    complexed with h10, mes

Details for d3shjg_

PDB Entry: 3shj (more details), 2.8 Å

PDB Description: Proteasome in complex with hydroxyurea derivative HU10
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3shjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shjg_ d.153.1.4 (G:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3shjg_:

Click to download the PDB-style file with coordinates for d3shjg_.
(The format of our PDB-style files is described here.)

Timeline for d3shjg_: