Lineage for d3shjb_ (3shj B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1044829Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 1044845Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045069Domain d3shjb_: 3shj B: [185381]
    Other proteins in same PDB: d3shj1_, d3shj2_, d3shjg_, d3shjh_, d3shji_, d3shjj_, d3shjk_, d3shjl_, d3shjm_, d3shjn_, d3shju_, d3shjv_, d3shjw_, d3shjx_, d3shjy_, d3shjz_
    automated match to d1g65b_
    complexed with h10, mes

Details for d3shjb_

PDB Entry: 3shj (more details), 2.8 Å

PDB Description: Proteasome in complex with hydroxyurea derivative HU10
PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d3shjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shjb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d3shjb_:

Click to download the PDB-style file with coordinates for d3shjb_.
(The format of our PDB-style files is described here.)

Timeline for d3shjb_: