SCOPe 2.08: Domain d3sb2b_: 3sb2 B:

Lineage for d3sb2b_ (3sb2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
   forms homohexameric ring structures

6. Protein automated matches [190062] (8 species)
   not a true protein

7. Species Herbaspirillum seropedicae [TaxId:757424] [189857] (1 PDB entry)

8. Domain d3sb2b_: 3sb2 B: [185329]
   automated match to d1hk9d_
   complexed with gol

Details for d3sb2b_

PDB Entry: 3sb2, 2.63 Å

PDB Description: crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1

PDB Compounds: (B:) Protein hfq

SCOPe Domain Sequences for d3sb2b_:

Sequence; same for both SEQRES and ATOM records:

>d3sb2b_ b.38.1.2 (B:) automated matches {Herbaspirillum seropedicae [TaxId: 757424]}
qllqdpflnalrkehvpvsiylvngiklqghvesfdqyvvllrntvtqmvykhaistvvp
aravn

Timeline for d3sb2b_:

• d3sb2b_ first appeared in SCOPe 2.01
  
• d3sb2b_ appears in SCOPe 2.07