Lineage for d3s97b_ (3s97 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1329314Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1329315Protein automated matches [191011] (3 species)
    not a true protein
  7. 1329319Species Human (Homo sapiens) [TaxId:9606] [188766] (6 PDB entries)
  8. 1329331Domain d3s97b_: 3s97 B: [185322]
    Other proteins in same PDB: d3s97c1, d3s97d1, d3s97d2
    automated match to d1jcza_
    complexed with nag

Details for d3s97b_

PDB Entry: 3s97 (more details), 2.3 Å

PDB Description: ptprz cntn1 complex
PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase zeta

SCOPe Domain Sequences for d3s97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s97b_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslentfih
ntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplemqiy
cfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaaldpfi
llnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsgyvm
lmdylqnnfreqqykfsrqvfssyt

SCOPe Domain Coordinates for d3s97b_:

Click to download the PDB-style file with coordinates for d3s97b_.
(The format of our PDB-style files is described here.)

Timeline for d3s97b_: