Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Lactobacillus plantarum [TaxId:1590] [189984] (1 PDB entry) |
Domain d3s3ta1: 3s3t A:4-146 [185260] Other proteins in same PDB: d3s3ta2, d3s3tb2, d3s3tc2, d3s3td2, d3s3te2, d3s3tf2, d3s3tg2, d3s3th2 automated match to d1wjga_ complexed with act, atp, ca, gol |
PDB Entry: 3s3t (more details), 1.9 Å
SCOPe Domain Sequences for d3s3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3ta1 c.26.2.0 (A:4-146) automated matches {Lactobacillus plantarum [TaxId: 1590]} rytnilvpvdssdaaqaafteavniaqrhqanltalyvvddsayhtpaldpvlselldae aahakdamrqrqqfvattsapnlkteisygipkhtiedyakqhpeidlivlgatgtnsph rvavgsttsyvvdhapcnvivir
Timeline for d3s3ta1: