Lineage for d3s3qa_ (3s3q A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634823Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189710] (4 PDB entries)
  8. 1634826Domain d3s3qa_: 3s3q A: [185256]
    automated match to d1qdqa_
    complexed with act, c1p

Details for d3s3qa_

PDB Entry: 3s3q (more details), 1.8 Å

PDB Description: Structure of cathepsin B1 from Schistosoma mansoni in complex with K11017 inhibitor
PDB Compounds: (A:) Cathepsin B-like peptidase (C01 family)

SCOPe Domain Sequences for d3s3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3qa_ d.3.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
ecsiesevtagrin

SCOPe Domain Coordinates for d3s3qa_:

Click to download the PDB-style file with coordinates for d3s3qa_.
(The format of our PDB-style files is described here.)

Timeline for d3s3qa_: