Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries) |
Domain d3s11a1: 3s11 A:11-323 [185243] Other proteins in same PDB: d3s11a2, d3s11b_, d3s11c2, d3s11d_, d3s11e2, d3s11f_ automated match to d1jsma_ complexed with gol, nag, tam |
PDB Entry: 3s11 (more details), 2.5 Å
SCOPe Domain Sequences for d3s11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s11a1 b.19.1.2 (A:11-323) automated matches {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekaspandlcypgdfnnyeelkhllsrtnhfekiqiipks swsnhdassgvssacpyhgkssffrnvvwlikknsayptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnt
Timeline for d3s11a1: