SCOPe 2.03: Domain d3rzwd_: 3rzw D:

Lineage for d3rzwd_ (3rzw D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)

8. Domain d3rzwd_: 3rzw D: [185231]
   Other proteins in same PDB: d3rzwa_
   automated match to d1a5ra_
   complexed with gol

Details for d3rzwd_

PDB Entry: 3rzw, 2.15 Å

PDB Description: crystal structure of the monobody ysmb-9 bound to human sumo1

PDB Compounds: (D:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d3rzwd_:

Sequence; same for both SEQRES and ATOM records:

>d3rzwd_ d.15.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d3rzwd_:

• d3rzwd_ first appeared in SCOPe 2.01
  
• d3rzwd_ appears in SCOPe 2.02
  
• d3rzwd_ appears in SCOPe 2.04
  
• d3rzwd_ appears in the current release, SCOPe 2.08