Lineage for d3rz6a_ (3rz6 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263128Protein Rubredoxin [57804] (8 species)
  7. 2263189Species Pyrococcus furiosus [TaxId:2261] [57809] (28 PDB entries)
    Uniprot P24297
  8. 2263218Domain d3rz6a_: 3rz6 A: [185223]
    automated match to d1bq8a_
    complexed with dod, fe

Details for d3rz6a_

PDB Entry: 3rz6 (more details), 1.75 Å

PDB Description: neutron structure of perdeuterated rubredoxin using 40 hours 1st pass data
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d3rz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rz6a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekl

SCOPe Domain Coordinates for d3rz6a_:

Click to download the PDB-style file with coordinates for d3rz6a_.
(The format of our PDB-style files is described here.)

Timeline for d3rz6a_: