SCOPe 2.01: Domain d3rseg_: 3rse G:

Lineage for d3rseg_ (3rse G:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family)

5. Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)

6. Protein automated matches [190348] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187175] (10 PDB entries)

8. Domain d3rseg_: 3rse G: [185145]
   Other proteins in same PDB: d3rsec_, d3rsee_, d3rsef_
   automated match to d1k8kg_

Details for d3rseg_

PDB Entry: 3rse, 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex

PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3rseg_:

Sequence, based on SEQRES records:

>d3rseg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintksq
avkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwh
ekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records):

>d3rseg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rfrkvdvgeydenkfvdeeagpdegevdsclrqgnmtaalqaalknppintksqavkdra
gsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaa
ggvgsivrvltarktv

Timeline for d3rseg_:

• d3rseg_ is new in SCOPe 2.01-stable
  
• d3rseg_ appears in SCOPe 2.02
  
• d3rseg_ appears in the current release, SCOPe 2.08