Lineage for d3rsef_ (3rse F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006006Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 3006007Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 3006042Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 3006043Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 3006055Domain d3rsef_: 3rse F: [185144]
    Other proteins in same PDB: d3rsea1, d3rsea2, d3rseb_, d3rsec_, d3rsed1, d3rsed2, d3rsee_, d3rseg_
    automated match to d1k8kf_

Details for d3rsef_

PDB Entry: 3rse (more details), 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d3rsef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsef_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d3rsef_:

Click to download the PDB-style file with coordinates for d3rsef_.
(The format of our PDB-style files is described here.)

Timeline for d3rsef_: