SCOPe 2.08: Domain d3rpsb_: 3rps B:

Lineage for d3rpsb_ (3rps B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries)

8. Domain d3rpsb_: 3rps B: [185096]
   automated match to d1jwha_
   complexed with 4b0, cl, so4

Details for d3rpsb_

PDB Entry: 3rps, 2.3 Å

PDB Description: Structure of human CK2alpha in complex with the ATP-competitive inhibitor 3-(4,5,6,7-tetrabromo-1H-benzotriazol-1-yl)propan-1-ol

PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3rpsb_:

Sequence; same for both SEQRES and ATOM records:

>d3rpsb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

Timeline for d3rpsb_:

• d3rpsb_ first appeared in SCOPe 2.01
  
• d3rpsb_ appears in SCOPe 2.07